PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000674514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 369aa    MW: 40962.9 Da    PI: 8.5898
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000674514genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.6e-53281551128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i++vd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ 
  MDP0000674514  28 LPPGFRFHPTDEELVVHYLKKKATSAPLPV-SIIADVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSg 122
                    79****************************.89***************988899***************************************995 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    + ++vg+kk Lvfy g+ pkg kt+W+mheyrl
  MDP0000674514 123 GIQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 155
                    5677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6424189IPR003441NAC domain
PROSITE profilePS5100561.78128189IPR003441NAC domain
PfamPF023654.2E-2829155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MESTDSSTGS QQQQLQPPQP PPPPLPNLPP GFRFHPTDEE LVVHYLKKKA TSAPLPVSII  60
ADVDLYKFDP WELPAKATFG EQEWYFFSPR DRKYPNGARP NRAATSGYWK ATGTDKPVLT  120
SGGIQKVGVK KALVFYGGKP PKGIKTNWIM HEYRLADNKP NNKPPGCDLG NKKNSLRLDD  180
WVLCRIYKKN NTHRPMDHER EDSMEDILGP LMPPSISHVG HHQNMKLHLP KSNLSYGPPF  240
MENNQIFFDG MMSSTDGSAS THQLPQKRPI VPSLYWNNQE EDDQTAADPS SSKRIQLHQL  300
DTGTNSNGDG INGGATNNNS TSIANLLSQL PQTPPLHQHA VLGSLGDGLF RTPYQLPGRN  360
WYSDSNLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-732719216168NAC domain-containing protein 19
4dul_A5e-732719216168NAC domain-containing protein 19
1ut7_B5e-732719216168NO APICAL MERISTEM PROTEIN
1ut7_A5e-732719216168NO APICAL MERISTEM PROTEIN
1ut4_B5e-732719216168NO APICAL MERISTEM PROTEIN
1ut4_A5e-732719216168NO APICAL MERISTEM PROTEIN
3swp_D5e-732719219171NAC domain-containing protein 19
3swp_C5e-732719219171NAC domain-containing protein 19
3swp_B5e-732719219171NAC domain-containing protein 19
3swp_A5e-732719219171NAC domain-containing protein 19
3swm_D5e-732719219171NAC domain-containing protein 19
3swm_C5e-732719219171NAC domain-containing protein 19
3swm_B5e-732719219171NAC domain-containing protein 19
3swm_A5e-732719219171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.98250.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981160.0KF198116.1 Malus hupehensis NAC domain protein (NAC32) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008386130.10.0PREDICTED: NAC domain-containing protein 18-like
SwissprotQ9LD441e-122NAC56_ARATH; NAC transcription factor 56
TrEMBLD9ZJA40.0D9ZJA4_MALDO; NAC domain class transcription factor
STRINGGLYMA12G34990.11e-160(Glycine max)
STRINGGLYMA13G35560.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-123NAC domain containing protein 2